PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G315700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 228aa    MW: 24594.1 Da    PI: 6.8507
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G315700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++lv     +G  +W+++++  g+ R++k+c++rw +yl
  Sevir.1G315700.2.p 14 KGPWTAEEDQKLVAFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYL 61
                        79******************************99************97 PP

2Myb_DNA-binding568.9e-1870111447
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          ++eE+ l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  Sevir.1G315700.2.p  70 LSEEEEALVIDLHAQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                         699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-21563IPR009057Homeodomain-like
PROSITE profilePS5129415.529961IPR017930Myb domain
SuperFamilySSF466897.49E-2811108IPR009057Homeodomain-like
SMARTSM007178.4E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
CDDcd001671.50E-101661No hitNo description
PROSITE profilePS5129428.28462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-2664117IPR009057Homeodomain-like
SMARTSM007175.0E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1570111IPR001005SANT/Myb domain
CDDcd001671.74E-1371112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTAE EDQKLVAFLL SHGHCCWRLV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEEEEALVID LHAQLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLKRMG  120
IDPVTHRPLS PAAPASAEPL QGAMSPASTA AAVSPSCSSS SAASASVATP GADVAAWPDP  180
IDLFQVDGIM DMDWAGILSG CGDDGAGVDV DLFDHYPGDG FDQQVWM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9646201e-168EU964620.1 Zea mays clone 280394 odorant 1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953828.11e-146PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-83ODO1_PETHY; Protein ODORANT1
TrEMBLK3Z1081e-146K3Z108_SETIT; Uncharacterized protein
STRINGSi020225m1e-146(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-79myb domain protein 20